GMSA - Multiple Sequence Alignment (GYDE)
WebGL-accelerated multiple sequence alignment visualization with support for large datasets. Originally from the GYDE (Genentech Antibody Design Environment) application.
Live Demo
Features
WebGL Rendering
Hardware-accelerated rendering supports thousands of sequences with smooth scrolling.
Color Schemes
Multiple amino acid coloring schemes including Clustal, hydrophobicity, and custom.
Selection & Navigation
Click to select sequences, drag to pan, with synchronized highlighting.
Column Selection
Select columns for mutation analysis and design.
Heatmap Overlay
Overlay data values like binding affinity or expression levels.
Implementation Guide
Step 1: Install Dependencies
Add the required packages to your project:
npm install react-resize-detector use-device-pixel-ratio color-nameStep 2: Copy Component Files
Copy the GMSA directory to your project:
src/gyde/gmsa/MSView.js- Main WebGL viewersrc/gyde/gmsa/Heatmap.js- Data overlay componentsrc/gyde/gmsa/glUtils.js- WebGL utilitiessrc/gyde/gmsa/HeatmapUtils.js- Color scale helpers
Step 3: Prepare Alignment Data
Format your multiple sequence alignment as an array of strings:
// Each string is one aligned sequence (same length, gaps as '-')
const sequences = [
'EVQLVESGGGLVQPGG-SLRLSCAASGFTFS',
'QVQLVQSGAEVKKPGA-SVKVSCKASGYTFT',
'EVQLLESGGGLVQPGGSLRLSCAASGFTFS-',
// ... more sequences
];
// Optional: sequence names/IDs
const sequenceNames = ['Ab001', 'Ab002', 'Ab003'];
// Optional: heatmap data (one value per sequence)
const heatmapValues = [0.95, 0.87, 0.92];Step 4: Add the Component
Import and render the MSView component:
import MSView from './gyde/gmsa/MSView';
function MyApp() {
const [selection, setSelection] = useState([]);
return (
<div style={{ height: '500px' }}>
<MSView
sequences={sequences}
names={sequenceNames}
selection={selection}
onSelect={setSelection}
colorScheme="clustal"
showHeatmap={true}
heatmapValues={heatmapValues}
/>
</div>
);
}Step 5: Configure Color Schemes
Available color schemes: clustal,hydrophobicity,taylor, or custom.
WebGL Architecture
The MSView component uses instanced rendering for efficient display:
- Font atlas texture for character rendering
- Instanced quads for background colors
- Selection and marker overlays
- HiDPI support with device pixel ratio detection
Related Components
Heatmap
Visualize data matrices with customizable color scales (magma, viridis, etc.)
Sequence Logo
Display sequence conservation as logo plots.
MS Table
Tabular view with sortable columns and data integration.